Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008771-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008771-M02, RRID:AB_519114
- Product name
- TNFRSF6B monoclonal antibody (M02), clone 7G5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TNFRSF6B.
- Antigen sequence
ETPTYPWRDAETGERLVCAQCPPGTFVQRPCRRDS
PTTCGPCPPRHYTQFWNYLERCRYCNVLCGEREEE
ARACHATHNRACRCRTGFFAHAGFCLEHASCPPGA
GVIAP- Isotype
- IgG
- Antibody clone number
- 7G5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references EGFR-driven up-regulation of decoy receptor 3 in keratinocytes contributes to the pathogenesis of psoriasis.
Wu NL, Huang DY, Hsieh SL, Hsiao CH, Lee TA, Lin WW
Biochimica et biophysica acta 2013 Oct;1832(10):1538-48
Biochimica et biophysica acta 2013 Oct;1832(10):1538-48
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TNFRSF6B is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TNFRSF6B on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol