HPA019206

AQP1 antibody from Atlas Antibodies
CHIP28, CO
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019206
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019206, RRID:AB_1844965
Product name
Anti-AQP1
Provider product page
Atlas Antibodies - HPA019206
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMK
PK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -