Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406013 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Indolethylamine N-Methyltransferase (INMT) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-INMT antibody: synthetic peptide directed towards the N terminal of human INMT
- Description
- Affinity Purified
- Reactivity
- Human, Rabbit
- Host
- Rabbit
- Antigen sequence
KGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAE
MLKFN LECLHKTFGP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Arylamine N-methyltransferase and thiol methyltransferase activities in cholestatic rat liver induced by common bile duct ligation.
[Relation of hypertension to diabetic nephropathy in patients with non-insulin-dependent diabetes mellitus--a pair-matched case-control study].
Kim YH, Joo 2nd
Experimental & molecular medicine 2001 Mar 31;33(1):23-8
Experimental & molecular medicine 2001 Mar 31;33(1):23-8
[Relation of hypertension to diabetic nephropathy in patients with non-insulin-dependent diabetes mellitus--a pair-matched case-control study].
Hou XH, Wang JH, Feng P
Zhongguo yi xue ke xue yuan xue bao. Acta Academiae Medicinae Sinicae 2001 Feb;23(1):23-6
Zhongguo yi xue ke xue yuan xue bao. Acta Academiae Medicinae Sinicae 2001 Feb;23(1):23-6
No comments: Submit comment
No validations: Submit validation data