HPA008712

PCDHAC2 antibody from Sigma-Aldrich
PCDH-ALPHA-C2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008712
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008712, RRID:AB_1079575
Product name
Anti-PCDHA13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008712
Antibody type
Polyclonal
Antigen
Protocadherin alpha-C2 Precursor (PCDH-alpha-C2)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQ
QWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYG
PGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQ
IDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGN
STT
Storage
-20C
Provider Type Product Number
- No reagents -