HPA027236

KRT20 antibody from Atlas Antibodies
CK20, K20, MGC35423
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027236
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027236, RRID:AB_1852224
Product name
Anti-KRT20
Provider product page
Atlas Antibodies - HPA027236
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEHQEEVDGLHKHLGNTVNVEVDAAPGLNLGVIMN
EMRQKYEVMAQKNLQEAKEQFERQTAVLQQQVTVN
TEELKGTEVQLTELRRTSQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -