Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91564 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-KRT20
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSV
YGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNE
KMAMQNLND- Epitope
- Binds to an epitope located within the peptide sequence - as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL9390
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human rectum and prostate tissues using AMAb91564 antibody. Corresponding KRT20 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows no positivity in non-germinal center cells as expected.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong membranous / cytoplasmic positivity in glandular cells.