HPA024684

KRT20 antibody from Sigma-Aldrich
CK20, K20, MGC35423
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024684
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024684, RRID:AB_1852222
Product name
Anti-KRT20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024684
Antibody type
Polyclonal
Antigen
Keratin, type I cytoskeletal 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASYLEKVRTLEQSNSKLEVQIKQWYETNAPRAGRD
YSAYYRQIEELRSQIKDAQLQNARCVLQIDNAKLA
A
Storage
-20C
Provider Type Product Number
- No reagents -