HPA005726

JMJD7 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005726
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005726, RRID:AB_1852017
Product name
Anti-JMJD7-PLA2G4B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005726
Antibody type
Polyclonal
Antigen
JmjC domain-containing protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELPQ
LLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTS
LHKDHYENLYCVVSGEKHFLFHPPSDRPFIPYELY
TPATYQLTE
Storage
-20C
Provider Type Product Number
- No reagents -