Antibody data

Product number
H00001674-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001674-M03, RRID:AB_1137164
Product name
DES monoclonal antibody (M03), clone 1D12
Provider product page
Abnova Corporation - H00001674-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DES.
Antigen sequence
SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVK
MALDVEIATYRKLLEGEESRINLPIQTYSALNFRE
TSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQ
QHEVL
Isotype
IgG
Antibody clone number
1D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -