Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001674-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001674-M03, RRID:AB_1137164
- Product name
- DES monoclonal antibody (M03), clone 1D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DES.
- Antigen sequence
SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVK
MALDVEIATYRKLLEGEESRINLPIQTYSALNFRE
TSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQ
QHEVL- Isotype
- IgG
- Antibody clone number
- 1D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Fluorophore-labeled nanocapsules displaying IgG Fc-binding domains for the simultaneous detection of multiple antigens.
Iijima M, Matsuzaki T, Yoshimoto N, Niimi T, Tanizawa K, Kuroda S
Biomaterials 2011 Dec;32(34):9011-20
Biomaterials 2011 Dec;32(34):9011-20
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DES is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol