HPA014232

P2RY11 antibody from Sigma-Aldrich
P2Y11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014232
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014232, RRID:AB_1854883
Product name
Anti-P2RY11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014232
Antibody type
Polyclonal
Antigen
PPAN-P2RY11 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLNVDARRRWSTRCPSFADIAQATAALELGPYVGY
QVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGY
RDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELS
Q
Storage
-20C
Provider Type Product Number
- No reagents -