HPA008467

NME2 antibody from Sigma-Aldrich
NDPKB, NM23-H2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008467
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008467, RRID:AB_1079492
Product name
Anti-NME1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008467
Antibody type
Polyclonal
Antigen
Nucleoside diphosphate kinase B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIA
IKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
Storage
-20C
Provider Type Product Number
- No reagents -