Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004830-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004830-M02, RRID:AB_489777
- Product name
- NME1 monoclonal antibody (M02), clone 1D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NME1.
- Antigen sequence
ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMV
WEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQV
GRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQ
NWIYE- Isotype
- IgG
- Antibody clone number
- 1D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Identification of antigenic proteins associated with trichloroethylene-induced autoimmune disease by serological proteome analysis.
Liu J, Xing X, Huang H, Jiang Y, He H, Xu X, Yuan J, Zhou L, Yang L, Zhuang Z
Toxicology and applied pharmacology 2009 Nov 1;240(3):393-400
Toxicology and applied pharmacology 2009 Nov 1;240(3):393-400
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in different cell lines.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in HeLa(Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NME1 expression in transfected 293T cell line by NME1 monoclonal antibody (M02), clone 1D7.Lane 1: NME1 transfected lysate(19.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of NME1 transfected lysate using anti-NME1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NME1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
