PA5-79743
NME1 antibody from Invitrogen Antibodies
NDPKA, NM23, NM23-H1
- Western blot
Supportive data in Antibodypedia
- Immunocytochemistry
Recommended by provider
- Immunohistochemistry
- Recommended by provider
- Flow cytometry
- Recommended by provider
Antibody data
- Antibody Data
- Knockdown Reagents [0]
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PA5-79743
- Provider
- Invitrogen Antibodies
- Product name
- Anti-NME1 Polyclonal Antibody
- Provider product page
- Invitrogen Antibodies - PA5-79743
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide
- Description
- The synthetic peptide sequence is 26-58aa, KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 100 µg
- Concentration
- 500 µg/mL
- Storage
- -20°C
| Provider | Type | Product Number |
|---|---|---|
| - No reagents - | ||
