PA5-79743

NME1 antibody from Invitrogen Antibodies
NDPKA, NM23, NM23-H1
Western blot
Supportive data in Antibodypedia
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider
Flow cytometry
Recommended by provider

Antibody data

Product number
PA5-79743
Provider
Invitrogen Antibodies
Product name
Anti-NME1 Polyclonal Antibody
Provider product page
Invitrogen Antibodies - PA5-79743
Antibody type
Polyclonal
Antigen
Synthetic peptide
Description
The synthetic peptide sequence is 26-58aa, KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Reactivity
Human, Mouse, Rat
Host
Rabbit
Isotype
IgG
Vial size
100 µg
Concentration
500 µg/mL
Storage
-20°C
Provider Type Product Number
- No reagents -