Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008467 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008467, RRID:AB_1079492
- Product name
- Anti-NME1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIA
IKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Toponostics of invasive ductal breast carcinoma: combination of spatial protein expression imaging and quantitative proteome signature analysis.
Röwer C, Ziems B, Radtke A, Schmitt O, Reimer T, Koy C, Thiesen HJ, Gerber B, Glocker MO
International journal of clinical and experimental pathology 2011 Mar 31;4(5):454-67
International journal of clinical and experimental pathology 2011 Mar 31;4(5):454-67
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
- Sample type
- HUMAN