H00005098-M07

PCDHGC3 antibody from Abnova Corporation
PC-43, PC43, PCDH-GAMMA-C3, PCDH2

Antibody data

Product number
H00005098-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005098-M07, RRID:AB_1578480
Product name
PCDHGC3 monoclonal antibody (M07), clone 1C4
Provider product page
Abnova Corporation - H00005098-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PCDHGC3.
Antigen sequence
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHY
EIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVS
GASRRFFEVNRETGEMFVNDRLDREELCGTLPSCT
VTLELVVENPLELFSVEVVIQDINDNNPAFPTQEM
KLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELS
RNEYFALRVQTREDSTKYAELVLERALDREREPSL
QLVLTALDGGTPALSASLPIHIKVLDANDNAPVFN
QSLYRARVLEDAPSGTRVVQVLATDLDEGPNGEII
YSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDT
KLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAP
EITVTSVYSPVPEDAPLGTVIALLSVTDLDAGENG
LVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETV
PEYNLSITARDAGTPSLSALTIVRVQVSDINDNPP
QSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNA
RLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPL
DYEDRREFELTAHISDGGTPVLATNISVNIFVTDR
NDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVG
WDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVS
VTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLIL
VSVGFVVTVFGVIIFKVYKWKQSRDLYRAPVSSLY
RTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSD
PLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAES
APPGQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTW
PNNQFDTEMLQAMILASASEAADGSSTLGGGAGTM
GLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAA
GKRDGKAPAGGNGNKKKSGKKEKK
Isotype
IgG
Antibody clone number
1C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -