Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054659-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054659-M02, RRID:AB_607272
- Product name
- UGT1A3 monoclonal antibody (M02), clone 1C10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant UGT1A3.
- Antigen sequence
KVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPE
VNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQL
YFETEHFLKKFFRSMAMLNNMSLVYHRSCV- Isotype
- IgG
- Antibody clone number
- 1C10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Coffee induces expression of glucuronosyltransferases by the aryl hydrocarbon receptor and Nrf2 in liver and stomach.
Kalthoff S, Ehmer U, Freiberg N, Manns MP, Strassburg CP
Gastroenterology 2010 Nov;139(5):1699-710, 1710.e1-2
Gastroenterology 2010 Nov;139(5):1699-710, 1710.e1-2
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UGT1A3 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol