Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001936 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001936, RRID:AB_1079647
- Product name
- Anti-PNMA2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVI
FKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQE
GVSPATVPCISPELLAHLLGQAMAHAPQPLLPMRY
RKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPV
TEAEKKRWL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Whole genome RNA expression profiling of endoscopic biliary brushings provides data suitable for biomarker discovery in cholangiocarcinoma.
Paraneoplastic Antigen Ma2 Autoantibodies as Specific Blood Biomarkers for Detection of Early Recurrence of Small Intestine Neuroendocrine Tumors
Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas
Chapman MH, Tidswell R, Dooley JS, Sandanayake NS, Cerec V, Deheragoda M, Lee AJ, Swanton C, Andreola F, Pereira SP
Journal of hepatology 2012 Apr;56(4):877-85
Journal of hepatology 2012 Apr;56(4):877-85
Paraneoplastic Antigen Ma2 Autoantibodies as Specific Blood Biomarkers for Detection of Early Recurrence of Small Intestine Neuroendocrine Tumors
Cui T, Hurtig M, Elgue G, Li S, Veronesi G, Essaghir A, Demoulin J, Pelosi G, Alimohammadi M, Öberg K, Giandomenico V, Meuth S
PLoS ONE 2010 December;5(12)
PLoS ONE 2010 December;5(12)
Novel markers for enterochromaffin cells and gastrointestinal neuroendocrine carcinomas
Leja J, Essaghir A, Essand M, Wester K, öberg K, Tötterman T, Lloyd R, Vasmatzis G, Demoulin J, Giandomenico V
Modern Pathology 2008 October;22(2):261-272
Modern Pathology 2008 October;22(2):261-272
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and PNMA2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416096).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-PNMA2 antibody. Corresponding PNMA2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN