HPA001936

PNMA2 antibody from Sigma-Aldrich
MA2, RGAG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001936
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001936, RRID:AB_1079647
Product name
Anti-PNMA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001936
Antibody type
Polyclonal
Antigen
Paraneoplastic antigen Ma2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVI
FKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQE
GVSPATVPCISPELLAHLLGQAMAHAPQPLLPMRY
RKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPV
TEAEKKRWL
Storage
-20C
Provider Type Product Number
- No reagents -