Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00256356-M11 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00256356-M11, RRID:AB_534934
- Product name
- MGC40579 monoclonal antibody (M11), clone 2C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MGC40579.
- Antigen sequence
MSGLLTDPEQRAQEPRYPGFVLGLDVGSSVIRCHV
YDRAARVCGSSVQKVENLYPQIGWVEIDPDVLWIQ
FVAVIKEAVKAAGIQMNQI- Isotype
- IgG
- Antibody clone number
- 2C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MGC40579 expression in transfected 293T cell line by MGC40579 monoclonal antibody (M11), clone 2C11.Lane 1: MGC40579 transfected lysate(33.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GK5 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol