HPA017438

GPRASP2 antibody from Atlas Antibodies
FLJ37327, GASP2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA017438
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017438, RRID:AB_1849504
Product name
Anti-GPRASP2
Provider product page
Atlas Antibodies - HPA017438
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPLVVRPKVRTQATTGARPKTETKSVPAARPKTEA
QAMSGARPKTEVQVMGGARPKTEAQGITGARPKTD
ARAVGGARSKTDAKAIPGARPKDEAQAWAQSEFGT
EAVSQAEGVSQTNA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -