H00128646-B01P

SIRPD antibody from Abnova Corporation
dJ576H24.4, PTPNS1L2

Antibody data

Product number
H00128646-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00128646-B01P, RRID:AB_1580638
Product name
SIRPD purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00128646-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SIRPD protein.
Antigen sequence
MPIPASPLHPPLPSLLLYLLLELAGVTHVFHVQQT
EMSQTVSTGESIILSCSVPDTLPNGPVLWFKGTGP
NRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIR
EISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVT
EQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNS
TNYFVQPCCCLRLLGLTGLLSK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -