AMAb90874
antibody from Atlas Antibodies
Targeting: CD68
DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90874 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90874, RRID:AB_2665706
- Product name
- Anti-CD68
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTT
QGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFP
YG- Epitope
- Binds to an epitope located within the peptide sequence SPTSKETIGDYTWTN as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL1346
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1, using Anti-CD68 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human spleen tissue lysate
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong immunoreactivity in a subset of lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong positivity in Kupffer cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong immunoreactivity in a subset of lymphoid cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).