H00089866-B01

SEC16B antibody from Abnova Corporation
LZTR2, PGPR-p117, RGPR, Sec16S

Antibody data

Product number
H00089866-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00089866-B01, RRID:AB_1138581
Product name
LZTR2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00089866-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human LZTR2 protein.
Antigen sequence
MELWAPQRLPQTRGKATAPSKDPDRGFRRDGHHRP
VPHSWHNGERFHQWQDNRGSPQPQQEPRADHQQQP
HYASRPGDWHQPVSGVDYYEGGYRNQLYSRPGYEN
SYQSYQSPTMREEYAYGSYYYHGHPQWLQEERVPR
QRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSET
HFQSNSRNPCKDSPASNSGQEWPGELFPGSLLAEA
QKNKPSLASESNLLQQRESGLSSSSYELSQYIRDA
PERDDPPASAAWSPVQAEDVSSAGPKAPMKFYIPH
VPVSFGPGGQLVRVGPSSPTDGQAALVELHSMEVI
LNDSEEQEEMRSFSGPLIREDVHKVDIMTFCQQKA
AQSCKSETLGSRDSALLWQLLVLLCRQNGSMVGSD
IAELLMQDCKKLEKYKRQPPVANLINLTDEDWPVL
SSGTPNLLTGEIPPSVETPAQIVEKFTRLLYYGRK
KEALEWAMKNHLWGHALFLSSKMDPQTYSWVMSGF
TSTLALNDPLQTLFQLMSGRIPQAATCCGEKQWGD
WRPHLAVILSNQAGDPELYQRAIVAIGDTLAGKGL
VEAAHFCYLMAHVPFGHYTVKTDHLVLLGSSHRYA
TWEKGNSKDIFQGTVLALVGFYGSSFHFLM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -