Antibody data
- Product number
- HPA021147
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021147, RRID:AB_1854083
- Product name
- Anti-MPO
- Provider product page
- Atlas Antibodies - HPA021147
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLK
LARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALA
QISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human bone marrow shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis using Anti-MPO antibody HPA021147.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver using Anti-MPO antibody HPA021147.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-MPO antibody. Corresponding MPO RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human bone marrow, cerebral cortex, liver and testis using Anti-MPO antibody HPA021147 (A) shows similar protein distribution across tissues to independent antibody HPA061464 (B).
- Antibody #2 product nr
- HPA061464
- Antibody provider
- Atlas Antibodies
- Show more