HPA021147

MPO antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021147
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021147, RRID:AB_1854083
Product name
Anti-MPO antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021147
Antibody type
Polyclonal
Antigen
Myeloperoxidase Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLK
LARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALA
QISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNC
Storage
-20C
Provider Type Product Number
- No reagents -