Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001652-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001652-M01, RRID:AB_425397
- Product name
- DDT monoclonal antibody (M01), clone 1G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant DDT.
- Antigen sequence
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPA
DRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT
AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLES
WQIGKIGTVMTFL- Isotype
- IgG
- Antibody clone number
- 1G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references D-Dopachrome tautomerase is a candidate for key proteins to protect the rat liver damaged by carbon tetrachloride.
Hiyoshi M, Konishi H, Uemura H, Matsuzaki H, Tsukamoto H, Sugimoto R, Takeda H, Dakeshita S, Kitayama A, Takami H, Sawachika F, Kido H, Arisawa K
Toxicology 2009 Jan 8;255(1-2):6-14
Toxicology 2009 Jan 8;255(1-2):6-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DDT expression in transfected 293T cell line by DDT monoclonal antibody (M01), clone 1G1.Lane 1: DDT transfected lysate(12.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DDT is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol