H00001652-M04

DDT antibody from Abnova Corporation
D-DT, DDCT, MIF-2, MIF2

Antibody data

Product number
H00001652-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001652-M04, RRID:AB_1574278
Product name
DDT monoclonal antibody (M04), clone 1D5
Provider product page
Abnova Corporation - H00001652-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DDT.
Antigen sequence
MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPA
DRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT
AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLES
WQIGKIGTVMTFL
Isotype
IgG
Antibody clone number
1D5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -