H00063926-B03

ANKEF1 antibody from Abnova Corporation
ANKRD5, dJ839B4.6, FLJ21669

Antibody data

Product number
H00063926-B03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00063926-B03, RRID:AB_1571208
Product name
ANKRD5 MaxPab mouse polyclonal antibody (B03)
Provider product page
Abnova Corporation - H00063926-B03
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ANKRD5 protein.
Antigen sequence
MALADKGLENLQIYKVLQCVRNKDKKQIEKLTKLG
YPELINYTEPINGLSALHLASVSNDIDMVSFLLDL
GAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKA
DMTIVDNEGKGVLFYCILPTKRHYRCALIALEHGA
DVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGA
NPNAINSSTGRTALMEASREGVVEIVRGILERGGE
VNAFDNDRHHAAHFAAKGGFFDILKLLFAYNGDVG
LISINGNTPLHYAAMGGFADCCKYIAQRGCDLKWK
NLDHKTPRAVAKEGGFKAASKEIRRAERIANKLAR
PGAKNPNPLWALRLHDWSVEREAFLREAFAVLDRG
DGSISKNDFVMVLEERQDYASSEQLAAIAHLHEKT
RGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGM
GKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYM
IETYKNVTDSSRFNRDHPPEHPIQDDSVWYIDDSE
KVFSNINIITKAGDLASLKKAFESGIPVDMKDNYY
KTPLMTACASGNIDVVKFLLEKGANVNATDNFLWT
PLHFACHAGQQDIVELLVESGALIDAASINNSTPL
NRAIESCRLDTVKYLLDIGAKFQLENRKGHSAMDV
AKAYADYRIIDLIKEKLDNLPKPAENQKLKGKTPP
ILKTEGPEIKKEEELLSSIYGVPTTSEGKKVQKGN
VVHLNSLITSGYTKKVDITFIPRRIWSPEATTAEL
IRKRELRRERFTHEVDFDDFMMPFQKNITEKARAL
EAALKT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -