HPA013413

TBC1D32 antibody from Sigma-Aldrich
bA57L9.1, BROMI, C6orf170, C6orf171, dJ310J6.1, FLJ30899, FLJ34235
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013413
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013413, RRID:AB_10602702
Product name
Anti-C6orf170 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013413
Antibody type
Polyclonal
Antigen
Uncharacterized protein C6orf170 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYP
WPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLC
LKISDKQTEWIENCQRQFCKMMKAKPDIISGEALI
ELLEKFVLHLTESPSECYFPSVEYTATDANVKNE
Storage
-20C
Provider Type Product Number
- No reagents -