Antibody data
- Product number
- HPA000834
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000834, RRID:AB_1078977
- Product name
- Anti-G6PD
- Provider product page
- Atlas Antibodies - HPA000834
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWL
FRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKA
TPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHM
NALH
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Global variability in gene expression and alternative splicing is modulated by mitochondrial content
Guantes R, Rastrojo A, Neves R, Lima A, Aguado B, Iborra F
Genome Research 2015 May;25(5):633-644
TAp73 enhances the pentose phosphate pathway and supports cell proliferation
Du W, Jiang P, Mancuso A, Stonestrom A, Brewer M, Minn A, Mak T, Wu M, Yang X
Nature Cell Biology 2013 June;15(8):991-1000
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model
Kato B, Nicholson G, Neiman M, Rantalainen M, Holmes C, Barrett A, Uhlén M, Nilsson P, Spector T, Schwenk J
Proteome Science 2011 ;9(1):73
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line A-549.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Western blot analysis in human cell lines A-549 and HEK293 using Anti-G6PD antibody. Corresponding G6PD RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Western blot analysis using Anti-G6PD antibody HPA000834 (A) shows similar pattern to independent antibody HPA000247 (B).
- Sample type
- HUMAN
- Antibody #2 product nr
- HPA000247
- Antibody provider
- Atlas Antibodies
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in a subset of lymphoid cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in lymphoid cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human testis and kidney tissues using Anti-G6PD antibody. Corresponding G6PD RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA000834 antibody. Corresponding G6PD RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more