HPA000834

G6PD antibody from Atlas Antibodies
G6PD1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000834
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000834, RRID:AB_1078977
Product name
Anti-G6PD
Provider product page
Atlas Antibodies - HPA000834
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWL
FRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKA
TPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHM
NALH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -