HPA000834

G6PD antibody from Sigma-Aldrich
G6PD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000834
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000834, RRID:AB_1078977
Product name
Anti-G6PD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000834
Antibody type
Polyclonal
Antigen
Glucose-6-phosphate dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWL
FRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKA
TPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHM
NALH
Storage
-20C
Provider Type Product Number
- No reagents -