Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004609-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004609-M02, RRID:AB_463846
- Product name
- MYC monoclonal antibody (M02), clone 1G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MYC.
- Antigen sequence
VRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLER
QRRNELKRSFFALRDQIPELENNEKAPKVVILKKA
TAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQL
RNSCA- Isotype
- IgG
- Antibody clone number
- 1G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
Chen TC, Lee SA, Hong TM, Shih JY, Lai JM, Chiou HY, Yang SC, Chan CH, Kao CY, Yang PC, Huang CY
Journal of proteome research 2009 Nov;8(11):4943-53
Journal of proteome research 2009 Nov;8(11):4943-53
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of MYC expression in transfected 293T cell line by MYC monoclonal antibody (M02), clone 1G7.Lane 1: MYC transfected lysate(49.561 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MYC is 0.3 ng/ml as a capture antibody.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HeLa cells were stained with MYC-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
- Validation comment
- Immunofluorescence (Circulating Tumor Cell)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to MYC on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
