HPA034542
antibody from Atlas Antibodies
Targeting: IL36RN
FIL1, FIL1(DELTA), FIL1D, IL-1F5, IL1F5, IL1HY1, IL1L1, IL1RP3, IL36RA, MGC29840
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA034542 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA034542, RRID:AB_10602238
- Product name
- Anti-IL36RN
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGK
VIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC
GVGQEPTLTLEPVNIMELYLGA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The novel cytokine interleukin-36 is expressed in psoriatic and rheumatoid arthritis synovium
Frey S, Derer A, Messbacher M, Baeten D, Bugatti S, Montecucco C, Schett G, Hueber A
Annals of the Rheumatic Diseases 2013 August;72(9):1569-1574
Annals of the Rheumatic Diseases 2013 August;72(9):1569-1574
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and IL36RN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406658).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in keratinocytes.
- Sample type
- HUMAN