Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002335-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002335-B01P, RRID:AB_1573618
- Product name
- FN1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human FN1 protein.
- Antigen sequence
MSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNY
KIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEA
TCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGW
RCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNT
NVNCPIECFMPLDVQADREDSRE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FN1 MaxPab polyclonal antibody. Western Blot analysis of FN1 expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FN1 expression in transfected 293T cell line (H00002335-T01) by FN1 MaxPab polyclonal antibody.Lane 1: FN1 transfected lysate(23.21 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to FN1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between HGF and FN1. HeLa cells were stained with anti-HGF rabbit purified polyclonal 1:1200 and anti-FN1 mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)