ABIN502125

FN1 antibody from antibodies-online
CIG, FINC, GFND2, LETS, MSF

Antibody data

Product number
ABIN502125
Provider
antibodies-online
Product name
anti-Fibronectin 1 (FN1) antibody
Provider product page
antibodies-online - ABIN502125
Antibody type
Polyclonal
Antigen
The immunogen for anti-FN1 antibody: synthetic peptide directed towards the N terminal of human FN1
Reactivity
Human
Host
Rabbit
Antigen sequence
GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNT
YRVGD TYERPKDSMI
Vial size
50 µg
Provider Type Product Number
- No reagents -