Antibody data

Product number
H00006203-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006203-M03, RRID:AB_1137430
Product name
RPS9 monoclonal antibody (M03), clone 2D3
Provider product page
Abnova Corporation - H00006203-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RPS9.
Antigen sequence
VRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFK
LGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRL
DSQKHIDFSLRSPYGGGRPG
Isotype
IgG
Antibody clone number
2D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -