Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007490-M02 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007490-M02, RRID:AB_875934
- Product name
- WT1 monoclonal antibody (M02), clone 3B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant WT1.
- Antigen sequence
- QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNK
 RYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRS
 DQLKRHQRRHTGVKPFQCKTC
- Isotype
- IgG
- Antibody clone number
- 3B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of WT1 expression in transfected 293T cell line by WT1 monoclonal antibody (M02), clone 3B12.Lane 1: WT1 transfected lysate(34.5 KDa).Lane 2: Non-transfected lysate.
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged WT1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol