Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008897-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008897-M07, RRID:AB_1137316
- Product name
- MTMR3 monoclonal antibody (M07), clone 1E11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MTMR3.
- Antigen sequence
CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRS
YDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSL
ELSSLAGPGEDPLSADSLGKPTRVPG- Isotype
- IgG
- Antibody clone number
- 1E11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MTMR3 expression in transfected 293T cell line by MTMR3 monoclonal antibody (M07), clone 1E11.Lane 1: MTMR3 transfected lysate(133.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MTMR3 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MTMR3 on HeLa cell . [antibody concentration 15 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol