Antibody data

Product number
ABIN487076
Provider
antibodies-online
Product name
anti-Tumor Protein P53 (TP53) antibody
Provider product page
antibodies-online - ABIN487076
Antibody type
Polyclonal
Antigen
The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53
Reactivity
Human, Bovine, Porcine, Rabbit
Host
Rabbit
Antigen sequence
EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLP
SQAMD DLMLSPDDIE
Vial size
50 µg
Provider Type Product Number
- No reagents -