Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000438-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000438-A01, RRID:AB_463519
- Product name
- ASMT polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant ASMT.
- Antigen sequence
KLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSM
LKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAE
ELFTAIYRSEGERLQFMQALQEVWSVNGRS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Placental melatonin production and melatonin receptor expression are altered in preeclampsia: new insights into the role of this hormone in pregnancy.
Dynamics in enzymatic protein complexes offer a novel principle for the regulation of melatonin synthesis in the human pineal gland.
Lanoix D, Guérin P, Vaillancourt C
Journal of pineal research 2012 Nov;53(4):417-25
Journal of pineal research 2012 Nov;53(4):417-25
Dynamics in enzymatic protein complexes offer a novel principle for the regulation of melatonin synthesis in the human pineal gland.
Maronde E, Saade A, Ackermann K, Goubran-Botros H, Pagan C, Bux R, Bourgeron T, Dehghani F, Stehle JH
Journal of pineal research 2011 Aug;51(1):145-55
Journal of pineal research 2011 Aug;51(1):145-55
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ASMT polyclonal antibody (A01), Lot # COO0060228QCS1 Western Blot analysis of ASMT expression in HeLa ( Cat # L013V1 ).