HPA026437

WDR77 antibody from Sigma-Aldrich
MEP50, p44
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026437
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026437, RRID:AB_10600199
Product name
Anti-WDR77 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026437
Antibody type
Polyclonal
Antigen
WD repeat domain 77 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDT
KSTSCVLSSAVHSQCVTGLVFSPHSVPFLASL
Storage
-20C
Provider Type Product Number
- No reagents -