Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00246243-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00246243-M01, RRID:AB_530236
- Product name
- RNASEH1 monoclonal antibody (M01), clone 5D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RNASEH1.
- Antigen sequence
AACKAIEQAKTQNINKLVLYTDSMFTINGITNWVQ
GWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQW
MHVPGHSGFIGNEEADRLAREGAKQSED- Isotype
- IgG
- Antibody clone number
- 5D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RNASEH1 monoclonal antibody (M01), clone 5D10 Western Blot analysis of RNASEH1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RNASEH1 expression in transfected 293T cell line by RNASEH1 monoclonal antibody (M01), clone 5D10.Lane 1: RNASEH1 transfected lysate(32.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RNASEH1 monoclonal antibody (M01), clone 5D10. Western Blot analysis of RNASEH1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RNASEH1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol