Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311465 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ankyrin Repeat and SOCS Box-Containing 11 (ASB11) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ASB11 antibody: synthetic peptide directed towards the C terminal of human ASB11
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNA
QGKSA LDLAAPKSSV- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The novel gene asb11: a regulator of the size of the neural progenitor compartment.
Diks SH, Bink RJ, van de Water S, Joore J, van Rooijen C, Verbeek FJ, den Hertog J, Peppelenbosch MP, Zivkovic D
The Journal of cell biology 2006 Aug 14;174(4):581-92
The Journal of cell biology 2006 Aug 14;174(4):581-92
No comments: Submit comment
No validations: Submit validation data