HPA000238

ASB11 antibody from Sigma-Aldrich
DKFZp779E2460
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000238
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000238, RRID:AB_1078223
Product name
Anti-ASB11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000238
Antibody type
Polyclonal
Antigen
Ankyrin repeat and SOCS box protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSN
VEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVE
QALLLREGPPALSQLCRLCVRKCLGRACHQAIHKL
H
Storage
-20C
Provider Type Product Number
- No reagents -