WH0002952M1

GSTT1 antibody from Sigma-Aldrich
ELISA
Recommended by provider

Antibody data

Product number
WH0002952M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0002952M1, RRID:AB_1841798
Product name
Monoclonal Anti-GSTT1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0002952M1
Antibody type
Monoclonal
Antigen
GSTT1 (AAH07065, a.a. 1-241) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDL
IKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAI
LLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTT
LRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAEL
DVTLQLLEDKFLQNKAFLTGPHISLADLVAITELM
HPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEA
HEVILKAKDFPPADPTIKQKLMPWVLAMIR* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -