H00002952-A01

GSTT1 antibody from Abnova Corporation

Antibody data

Product number
H00002952-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002952-A01, RRID:AB_461726
Product name
GSTT1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00002952-A01
Antibody type
Polyclonal
Antigen
GSTT1 (AAH07065, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag.
Reactivity
Human
Host
Mouse
Antigen sequence
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDL
IKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAI
LLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTT
LRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAEL
DVTLQLLEDKFLQNKAFLTGPHISLADLVAITELM
HPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEA
HEVILKAKDFPPADPTIKQKLMPWVLAMIR
Vial size
50 µL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -