H00002952-M01

GSTT1 antibody from Abnova Corporation
Western blot
Recommended by provider
ELISA
Recommended by provider

Antibody data

Product number
H00002952-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002952-M01, RRID:AB_425469
Product name
GSTT1 monoclonal antibody (M01), clone 2E10-1B2
Provider product page
Abnova Corporation - H00002952-M01
Antibody type
Monoclonal
Antigen
GSTT1 (AAH07065, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reactivity
Human
Host
Mouse
Antigen sequence
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDL
IKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAI
LLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTT
LRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAEL
DVTLQLLEDKFLQNKAFLTGPHISLADLVAITELM
HPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEA
HEVILKAKDFPPADPTIKQKLMPWVLAMIR
Isotype
IgG
Vial size
100 µg
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -