Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002952-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002952-M01, RRID:AB_425469
- Product name
- GSTT1 monoclonal antibody (M01), clone 2E10-1B2
- Antibody type
- Monoclonal
- Antigen
- GSTT1 (AAH07065, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDL
IKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAI
LLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTT
LRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAEL
DVTLQLLEDKFLQNKAFLTGPHISLADLVAITELM
HPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEA
HEVILKAKDFPPADPTIKQKLMPWVLAMIR- Isotype
- IgG
- Vial size
- 100 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The prognostic and predictive power of redox protein expression for anthracycline-based chemotherapy response in locally advanced breast cancer.
Redox protein expression predicts radiotherapeutic response in early-stage invasive breast cancer patients.
Effects of azithromycin on glutathione S-transferases in cystic fibrosis airway cells.
Anti-glutathione S-transferase T1 antibody-mediated rejection in C4d-positive renal allograft recipients.
Woolston CM, Zhang L, Storr SJ, Al-Attar A, Shehata M, Ellis IO, Chan SY, Martin SG
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2012 Aug;25(8):1106-16
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc 2012 Aug;25(8):1106-16
Redox protein expression predicts radiotherapeutic response in early-stage invasive breast cancer patients.
Woolston CM, Al-Attar A, Storr SJ, Ellis IO, Morgan DA, Martin SG
International journal of radiation oncology, biology, physics 2011 Apr 1;79(5):1532-40
International journal of radiation oncology, biology, physics 2011 Apr 1;79(5):1532-40
Effects of azithromycin on glutathione S-transferases in cystic fibrosis airway cells.
Bergamini G, Cigana C, Sorio C, Della Peruta M, Pompella A, Corti A, Huaux FA, Leal T, Assael BM, Melotti P
American journal of respiratory cell and molecular biology 2009 Aug;41(2):199-206
American journal of respiratory cell and molecular biology 2009 Aug;41(2):199-206
Anti-glutathione S-transferase T1 antibody-mediated rejection in C4d-positive renal allograft recipients.
Aguilera I, Alvarez-Marquez A, Gentil MA, Fernandez-Alonso J, Fijo J, Saez C, Wichmann I, Nuñez-Roldan A
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2008 Jul;23(7):2393-8
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association 2008 Jul;23(7):2393-8
No comments: Submit comment
No validations: Submit validation data