AV48490

GSTT1 antibody from Sigma-Aldrich
No application information provided.

Antibody data

Product number
AV48490
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV48490, RRID:AB_1849803
Product name
Anti-GSTT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV48490
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human GSTT1 with an internal ID of Y01431
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADP
TIKQKLMPWVLAMIR
Storage
-20C
Provider Type Product Number
- No reagents -