ABIN487301

JUN antibody from antibodies-online
AP-1, c-Jun

Antibody data

Product number
ABIN487301
Provider
antibodies-online
Product name
anti-Jun Proto-Oncogene (JUN) antibody
Provider product page
antibodies-online - ABIN487301
Antibody type
Polyclonal
Antigen
The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine
Host
Rabbit
Antigen sequence
TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQ
SMTLN LADPVGSLKP
Vial size
50 μg
Storage
Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Provider Type Product Number
- No reagents -