Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487289 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-CAMP Responsive Element Binding Protein 1 (CREB1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CREB1 antibody: synthetic peptide directed towards the N terminal of human CREB1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DSQESVDSVTDSQKRREILSRRPSYRKILNDLSSD
APGVP RIEEEKSEEE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Lithium response and genetic variation in the CREB family of genes.
Mamdani F, Alda M, Grof P, Young LT, Rouleau G, Turecki G
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2008 Jun 5;147B(4):500-4
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2008 Jun 5;147B(4):500-4
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting